Thymosin beta-4 special offer

Product name Thymosin β4
Sequence (One-letter code) SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Molecular weight 4921.47 g/mol
Amount  10 mg  10 mg 
Description  Powder/salt  Powder/salt 
Counter-ion  TFA-  Cl- 
Purity ≥93-95%  ≥93-95% 
Additional information  Purity and counter-ion confirmed by HPLC and ion chromatography  Purity and counter-ion confirmed by HPLC and ion chromatography 
Price  269 €  469 € 

Acetylated Thymosin beta-4 special offer

Product name Acetylated Thymosin β4
Sequence (One-letter code) Ac-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Molecular weight 4963,51 g/mol
Amount 10 mg 10 mg
Description Powder/salt Powder/salt
Counter-ion TFA- Cl-
Purity ≥93-95% ≥93-95%
Additional information Purity and counter-ion confirmed by HPLC and ion chromatography Purity and counter-ion confirmed by HPLC and ion chromatography
Price 269 € 469 €