LL-37 special offer

Product name: LL-37 (cathelicidin, cathelin-associated antimicrobial peptide of human neutrophils)
Sequence (One-letter code): [LL-37, 37 aa]
Molecular weight: 4493,33 g/mol
Amount 10 mg 10 mg 10 mg 10 mg 100 mg
Description Powder/salt Powder/salt Powder/salt Powder Peptide on resin
Counter-ion TFA- AcO- Cl- Inner salt/none -
Purity ≥95% ≥95% ≥95% ≥95% -
Additional information Purity and counter-ion confirmed by HPLC and ion chromatography Purity and counter-ion confirmed by HPLC and ion chromatography Purity and counter-ion confirmed by HPLC and ion chromatography Purity and counter-ion confirmed by HPLC and ion chromatography 2-Chlorotrityl chloride resin with protected LL-37 (w/o Fmoc), approx. 16 mg of pure LL-37 (about 95%)
Price 269 € 99 € 469 € 469 € 749 € 369 €


LL-37 chromatogramLL-37 HPLCms ll-37


NMR LL-37
Helical-wheel presentaion of residues 2-31 of LL37 comprising
α-helical fragment present in the NMR-based structure.

Peptide NMR
The NMR-based structure of LL37 in dodecylphosphocholine
micelles showing the bending of the helix (PDB 2K6O).

Electrostatic potential map
Surface electrostatic potential map of LL37. The figure
was generated by the MOLMOL program.

NMR peptides
The NMR-based structure of LL37
in dodecylphosphocholine micelles (PDB2K6O).

ll-37 structure
View of LL37 structure looking through the coil
showing its amphipatic nature (PDB 2K6O).